(858) 665-2278

LL-37 Peptide: How the Human Body Produces It
RESEARCH USE ONLY - NOT FDA-APPROVED

LL-37 is not approved by the U.S. FDA for human use and is not lawful to administer to humans. Where it is offered for sale in the U.S., it is sold only as a 'Research Use Only' laboratory chemical, not as a medicine.

Status as of July 17, 2026

What is LL-37 and how is it produced in the human body?

LL-37 is the only cathelicidin the human body makes, and the body never builds it directly: the CAMP gene on chromosome 3p21.3 encodes an 18 kDa precursor called hCAP18, and a protease cut releases the 37-residue active peptide at the site where it is needed. The molecular account is well established in human cells and tissues. What remains genuinely contested is how much of its everyday work is bacterial killing rather than signaling, and none of this biology has been translated into an approved drug.

Gene: CAMP, chromosome 3p21.3 Precursor: hCAP18, 18 kDa Mature peptide: 37 residues, net charge about +6 Largest reservoir: neutrophil specific granules Main hormonal input: 1,25-dihydroxyvitamin D
The Bottom Line

LL-37 is the sole human cathelicidin, encoded by the four-exon CAMP gene at chromosome 3p21.3 and liberated by proteolytic cleavage from an 18 kDa hCAP18 precursor stored in neutrophil specific granules.

What kind of molecule is LL-37 and what does its name mean?

The name records nothing about what the molecule does. It marks two leucine residues at the start of the mature sequence and a length of 37 amino acids, and nothing more. The part that carries the function is the charge that sequence holds, roughly +6 at physiological pH, which is what pulls the peptide onto the anionic surfaces of bacterial membranes, lipopolysaccharide and lipoteichoic acid that host cells largely lack on their outer leaflet.

  • Sequence and charge: [LL-37, 37 aa], net charge roughly +6 from six lysines and five arginines.
  • Conformation: mostly disordered in dilute solution, folding into an amphipathic alpha helix on anionic membranes.
  • Family definition: cathelicidin membership is set by the conserved cathelin prodomain, not by the antimicrobial peptide.
  • Aliases in the literature: hCAP18/LL-37 and CAP-18 denote the precursor; FALL-39 was the original cloning designation.
Key Fact

LL-37 is named for the two leucine residues opening its 37-amino-acid sequence, which carries a net positive charge of roughly +6 at physiological pH from six lysines and five arginines.

Which gene encodes LL-37 and what is the hCAP18 precursor?

CAMP is a single four-exon gene, and the split between its exons lands almost exactly on the split in the protein it makes: exons 1 through 3 carry the signal peptide and the cathelin domain, exon 4 carries the antimicrobial domain that becomes LL-37. The promoter is unusually busy for an antimicrobial peptide gene, holding a vitamin D response element alongside binding sites for C/EBP-alpha, NF-kB, AP-1 and STAT3, which is the molecular reason hormonal status, differentiation state and inflammatory signaling all move expression at once.

  1. Translation: a preproprotein of about 170 residues, signal peptide plus cathelin prodomain plus the 37-residue tail.
  2. Signal cleavage: the roughly 30-residue signal peptide is removed in the endoplasmic reticulum, leaving hCAP18 at 18 kDa.
  3. Granule loading: in neutrophils hCAP18 travels the secretory pathway into specific (secondary) granules and is held there as cargo.
  4. Proteolytic release: a cut at the junction of the cathelin and antimicrobial domains frees the mature 37-residue peptide.
Worth Knowing

The isolated human cathelin-like domain does not inhibit LL-37 and unprocessed hCAP18 inhibits Gram-negative growth with efficiency comparable to the mature peptide, so the familiar account of the prodomain as a safety catch is less settled than it is usually presented.

Which cells and tissues in the body produce LL-37?

Neutrophils are the largest source, and the common assumption that they make the peptide on demand is wrong: circulating neutrophils do not synthesize it at all. Synthesis happens in the bone marrow during granulopoiesis, at the myelocyte and metamyelocyte stages, and the mature cell leaves carrying a pre-loaded supply it will never replenish. That arrangement makes the response immediate on degranulation and also finite.

Tier 1, the neutrophil reservoir: the single largest store in the body, loaded during granulopoiesis and released on degranulation.
hCAP18 is packed into specific (secondary) granules at the myelocyte and metamyelocyte stages.
Tier 2, other leukocytes: monocytes, macrophages, NK cells, gamma-delta T cells, B cells and mast cells, generally at lower levels and often inducibly.
Tier 3, barrier epithelium: keratinocytes, airway from nose to alveolus, gut including colonocytes, salivary and eccrine sweat glands, ocular surface, gastric mucosa, testis, epididymis and mammary gland.
Sweat glands, salivary glands and the epididymis express it constitutively, while normal epidermis carries relatively little until wounding or infection drives it up.
Tier 4, less settled sites: endothelial cells, osteoblasts, adipocytes and some tumor cells, where the physiological significance is reported but not established.
Technical Verdict

Neutrophils hold the body's largest LL-37 reservoir as hCAP18 loaded into specific granules during bone-marrow granulopoiesis, a finite supply the circulating cell never replenishes.

How is the inactive hCAP18 precursor converted into active LL-37?

Activation is a single proteolytic cut, and the enzyme that makes it changes entirely with the tissue. That tissue specificity is not a footnote, because it decides which molecule actually reaches the surface: skin does not stop at LL-37, and seminal plasma produces a different peptide altogether. The lack of selectivity is worth stating plainly as well, since a free amphipathic cationic helix is cytotoxic to host cells at concentrations only modestly above its antibacterial range, which is why keeping the activating protease and its substrate in separate compartments until exocytosis reads as a safety arrangement.

Site Neutrophil degranulation Skin (stratum corneum) Seminal plasma
Enzyme Proteinase 3, from azurophil granules KLK5 and KLK7 Gastricsin, also called pepsin C
Trigger Exocytosis brings enzyme and substrate together outside the cell Desquamation-linked processing Acidic pH after ejaculation
Product LL-37 LL-37 plus shorter forms including RK-31 and KS-30 ALL-38, LL-37 with one extra N-terminal alanine
Established Fact

Proteinase 3 cleaves the alanine-leucine bond at the cathelin junction to release LL-37 when neutrophils degranulate, while skin kallikreins KLK5 and KLK7 and seminal gastricsin generate different mature forms from the same hCAP18 precursor.

How does vitamin D regulate LL-37 production?

The mechanism here is unusually well defined for a nutrient-to-gene link, and it is also the point where the literature most often overreaches. In human monocytes and macrophages the cell manufactures its own active hormone locally and uses it to switch on CAMP, which makes this one of the clearest vitamin D target genes in innate immunity. Cross-sectional studies linking low 25-hydroxyvitamin D to lower peptide levels are inconsistent, and supplementation trials report increases, no change, or effects that depend on baseline status, dose and tissue, so the clinical claim is not settled even though the cell biology is.

  1. Pattern recognition: TLR2/1 stimulation of human monocytes and macrophages upregulates both the vitamin D receptor and CYP27B1.
  2. Local activation: CYP27B1 converts circulating 25-hydroxyvitamin D into the active hormone 1,25-dihydroxyvitamin D inside the cell.
  3. Receptor docking: the hormone-bound vitamin D receptor heterodimerizes with RXR and binds the vitamin D response element in the CAMP promoter.
  4. Transcription: CAMP expression rises; in the 2006 Science report by Liu and colleagues, serum from vitamin D deficient donors supported this response poorly until 25-hydroxyvitamin D was added back.
The Lay of the Land

The vitamin D response element in the CAMP promoter derives from an Alu element inserted in the primate lineage and is absent from the mouse and rat genes, so rodent models cannot test this pathway at all.

What signals cause the body to increase LL-37 production during infection or injury?

Induction cannot be the front line. Transcription takes hours, while the pre-loaded neutrophil store empties in seconds to minutes, so the signals below raise the local baseline over the days after an insult rather than meeting it. They are not equally well evidenced, and the ranking carries more information than the list does.

Best documented, skin injury: keratinocytes at the wound edge upregulate CAMP within hours, with reported peaks around 48 hours before falling back as the wound closes.
Blocking the peptide in that setting impairs re-epithelialization, which argues the induction is functional rather than incidental.
Well supported, pattern recognition: TLR2/1 engagement in monocytes and macrophages induces expression indirectly through CYP27B1 and the vitamin D receptor, and TLR4 signaling has similar effects in some cell types.
Well supported, microbial metabolites: butyrate from commensal fermentation is a potent inducer in colonic epithelium.
Directional, cytokines: IL-1beta, IL-6, IL-17A and IL-22 raise keratinocyte expression, and the Th2 cytokines IL-4 and IL-13 suppress it.
That suppression is the leading explanation for the lower antimicrobial peptide burden in atopic dermatitis skin than in psoriatic skin, and a plausible contributor to the heavy Staphylococcus aureus colonization typical of atopic dermatitis.
Worth Understanding

Transcriptional induction of CAMP takes hours, so the immediate response to infection or injury comes from pre-formed neutrophil stores released on degranulation, with epithelial induction raising the local baseline over the following days.

What biological roles does LL-37 serve beyond direct antimicrobial killing?

Calling this a host defense peptide rather than an antibiotic reflects a real shift in how the field reads it, because at the concentrations present in most tissues the signaling functions are probably more consequential than the killing. Describing that signaling as anti-inflammatory is an oversimplification the data do not support: it dampens some TLR responses and amplifies others depending on cell type and stimulus.

  • Chemotaxis: attracts neutrophils, monocytes, mast cells and T cells, mainly through formyl peptide receptor FPR2.
  • Endotoxin neutralization: binds lipopolysaccharide and lipoteichoic acid with high affinity, blunting TLR4-driven responses.
  • Wound repair and angiogenesis: transactivates EGFR on keratinocytes and drives vessel formation through endothelial FPR2.
  • Nucleic acid complexing: condenses self-DNA into nuclease-resistant complexes that trigger TLR9 in plasmacytoid dendritic cells.
Expert Note

LL-37 binds self-DNA into condensed, nuclease-resistant complexes that reach endosomal TLR9 in plasmacytoid dendritic cells, something self-DNA alone does not achieve and a mechanism central to current models of psoriasis.

What concentrations of LL-37 are found in human tissues and body fluids?

The published numbers only make sense once the geography is clear, because systemic and local concentrations differ by orders of magnitude. Plasma levels sit well below what kills bacteria in a test tube, while the fluid immediately beside a degranulating neutrophil is higher than bulk sampling can measure. The peptide behaves as something that works in local hot spots, not as a circulating antibiotic.

Plasma, healthy adults: roughly 1 to 2 micrograms per mL Neutrophil content: about 0.6 to 0.8 micrograms hCAP18 per million cells Wound fluid and purulent exudate: reported in the tens of micrograms per mL Most commercial ELISAs: detect hCAP18, not cleaved LL-37
Expert Insight

Most commercial ELISAs raise antibodies against the precursor and report total hCAP18 rather than cleaved LL-37, so a published concentration usually describes the reservoir rather than the active peptide.

How is LL-37 broken down or cleared once it has been released?

Nothing about this peptide is built to last, and the mature 37-residue form is an intermediate in a processing cascade rather than a stable endpoint. Free peptide at an inflamed site persists on the order of minutes to a few hours depending on the local protease burden, and much of what circulates is bound and inactive rather than free. The fragments are not uniformly dead: several shorter forms stay bactericidal while giving up chemotactic capacity.

  • Host proteolysis: skin kallikreins trim it to RK-31 and KS-30; elastase and cathepsins degrade it further.
  • Bacterial proteases: aureolysin, V8, pseudomonal elastase, gingipains, ZapA, gelatinase and SpeB cleave and inactivate it.
  • Charge shielding: Staphylococcus aureus MprF lysylation and Dlt D-alanylation reduce the anionic pull that draws it in.
  • Carrier sequestration: apolipoprotein A-I, glycosaminoglycans, mucins and the DNA in pus bind and silence free peptide.
The Long View

Rapid proteolysis, salt and serum inhibition and a narrow window between antibacterial and cytotoxic concentrations have kept the native sequence from translating into an approved drug, pushing development toward protease-resistant analogs, D-amino acid substitutions, peptidomimetics and protected delivery.

How does human LL-37 compare with cathelicidins found in other species?

What is conserved across every cathelicidin is the cathelin prodomain, not the antimicrobial peptide. The business end is the most divergent part of the molecule, the opposite of the usual pattern, and the family runs from amphipathic helices like LL-37 and mouse CRAMP to the proline and arginine rich extended peptides of pigs and cattle, tryptophan-rich indolicidin and disulfide-stabilized porcine protegrins. Gene number diverges too, with humans and mice carrying exactly one cathelicidin gene while cattle carry at least seven.

Criterion Human LL-37 Mouse CRAMP
Cathelicidin genes in the genome One (CAMP) One (Camp)
Mature-region sequence identity Reference sequence Around 65 percent identical
Alu-derived vitamin D response element Present, primate insertion Absent
Vitamin D regulation of the gene Direct transcriptional target None reported through this element
The Deciding Factor

Mouse CRAMP shares only around 65 percent identity with LL-37 across the mature region and its gene lacks the primate Alu-derived vitamin D response element, so a mouse knockout phenotype cannot be read as a direct prediction of human biology, least of all for vitamin D.

Educational use only. This article describes what the published scientific and clinical literature reports about LL-37. It is not medical advice, and it does not recommend, prescribe, or tell anyone to use anything described here. The regulatory status shown at the top of this page reflects what the record showed on the date given there and can change. mdpep.com does not sell any substance described here, does not endorse human use of it, and does not direct anyone to obtain it.

This is not guidance for your situation. Nothing here accounts for your medical history, your current medications, or anything else specific to you, and none of it should be used to make a decision about your own health.

Affiliate disclosure. Some links on this site are affiliate links, and mdpep.com may earn a commission when they are used. That never affects what is written here, it is not an endorsement of any vendor, and it is not a statement that anything described on this page is available to buy.

Daniel Zengel
Written by Daniel Zengel
Medical Writer
Daniel Zengel is the principal owner of MD PEP and PRP Labs and a medical writer focused on neutral, primary‑source‑driven coverage of the peptide market. He draws on more than a decade in pharmaceutical and medical device roles, with a focus on regenerative medicine and platelet‑rich plasma (PRP) systems for US‑based clinics.

Need more help?

Have a question about this peptide? Send a note and we'll point you in the right direction.

Why you can trust this page

Every claim here ties to a named primary source and a date, written as plain documentation with nothing for sale. That is how MD PEP covers the whole peptide market.